VprBP Antibody
| Name | VprBP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49073 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:IAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | VprBP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | VPRBP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: VprBP Antibody [NBP2-49073] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli fibrillar center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7834_VprBP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49073-img0003.jpg)
Immunocytochemistry/Immunofluorescence: VprBP Antibody [NBP2-49073] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli fibrillar center.
![Immunohistochemistry-Paraffin: VprBP Antibody [NBP2-49073] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7835_VprBP-Antibody-Immunohistochemistry-Paraffin-NBP2-49073-img0002.jpg)
Immunohistochemistry-Paraffin: VprBP Antibody [NBP2-49073] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.