AP1AR antibody
| Name | AP1AR antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330683 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-AP1AR antibody is: synthetic peptide directed towards the C-terminal region of Human AP1AR. Synthetic peptide located within the following region: DSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSA. |
| Description | Rabbit Polyclonal |
| Gene | AP1AR |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: AP1AR; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml