Anti-TLR8 antibody
| Name | Anti-TLR8 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab53630 |
| Prices | $379.00 |
| Sizes | 100 µg |
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC-P |
| Species Reactivities | Mouse, Human |
| Antigen | Synthetic peptide: CESFQGLQNLTKINLNHNPNVQHQNGNPGI , corresponding to amino acids 81-109 of Human TLR8 Run BLAST with Run BLAST with |
| Description | Goat Polyclonal |
| Gene | TLR8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
