Anti-Themis antibody
| Name | Anti-Themis antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128272 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 587-636 ( RHHVDITKKLHPNQAGLDSKVLIGSQNDLVDEEKERSNRGATAIAETFKN ) of Human Themis (Q8N1K5) |
| Description | Rabbit Polyclonal |
| Gene | THEMIS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Themis antibody (ab128272) at 1 µg/ml + Jurkat cell lysate at 10 µg