Anti-RPA4 antibody
| Name | Anti-RPA4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81772 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Guinea Pig, Dog |
| Antigen | Synthetic peptide corresponding to a region within amino acids 215-264 ( HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD ) of Human RPA4 (NP_037479) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | RPA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RPA4 antibody (ab81772) at 1 µg/ml + fetal muscle lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution