Name | Anti-PPP1R10 antibody |
---|---|
Supplier | Abcam |
Catalog | ab84377 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | IHC-P |
Species Reactivities | Human, Rat, Chimpanzee, Monkey, Ape, Orangutan |
Antigen | Synthetic peptide corresponding to a region within amino acids 350-400 ( DRPGTPVPPVEVPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSV T ) of human PPP1R10 (SwissProt Q96QC0) |
Description | Rabbit Polyclonal |
Gene | PPP1R10 |
Conjugate | Unconjugated |
Supplier Page | Shop |