Anti-PPP1R10 antibody

Name Anti-PPP1R10 antibody
Supplier Abcam
Catalog ab84377
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-P
Species Reactivities Human, Rat, Chimpanzee, Monkey, Ape, Orangutan
Antigen Synthetic peptide corresponding to a region within amino acids 350-400 ( DRPGTPVPPVEVPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSV T ) of human PPP1R10 (SwissProt Q96QC0)
Description Rabbit Polyclonal
Gene PPP1R10
Conjugate Unconjugated
Supplier Page Shop

Product images