| Name | COPG2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3831 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK |
| Purity/Format | Affinity purified |
| Blocking Peptide | COPG2 Blocking Peptide |
| Description | Rabbit polyclonal COPG2 antibody raised against the N terminal of COPG2 |
| Gene | COPG2 |
| Supplier Page | Shop |