| Name | ADC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3996 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ADC antibody was raised using the middle region of ADC corresponding to a region with amino acids RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH |
| Purity/Format | Affinity purified |
| Blocking Peptide | ADC Blocking Peptide |
| Description | Rabbit polyclonal ADC antibody raised against the middle region of ADC |
| Gene | AZIN2 |
| Supplier Page | Shop |