| Name | ASPH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7074 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVD |
| Purity/Format | Affinity purified |
| Blocking Peptide | ASPH Blocking Peptide |
| Description | Rabbit polyclonal ASPH antibody raised against the N terminal of ASPH |
| Gene | ASPH |
| Supplier Page | Shop |