| Name | TMEM16A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7004 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TMEM16A antibody was raised using the middle region of TMEM16A corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMEM16A Blocking Peptide |
| Description | Rabbit polyclonal TMEM16A antibody raised against the middle region of TMEM16A |
| Gene | ANO1 |
| Supplier Page | Shop |