| Name | PECI antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2299 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK |
| Purity/Format | Affinity purified |
| Blocking Peptide | PECI Blocking Peptide |
| Description | Rabbit polyclonal PECI antibody raised against the middle region of PECI |
| Gene | ECI2 |
| Supplier Page | Shop |