| Name | PIGK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7113 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIGK Blocking Peptide |
| Description | Rabbit polyclonal PIGK antibody raised against the N terminal of PIGK |
| Gene | PIGK |
| Supplier Page | Shop |