| Name | DHDDS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3031 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DHDDS antibody was raised using the N terminal of DHDDS corresponding to a region with amino acids NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR |
| Purity/Format | Affinity purified |
| Blocking Peptide | DHDDS Blocking Peptide |
| Description | Rabbit polyclonal DHDDS antibody raised against the N terminal of DHDDS |
| Gene | DHDDS |
| Supplier Page | Shop |