| Name | THOC4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1327 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | THOC4 antibody was raised using the N terminal of THOC4 corresponding to a region with amino acids GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | THOC4 Blocking Peptide |
| Description | Rabbit polyclonal THOC4 antibody raised against the N terminal of THOC4 |
| Gene | ALYREF |
| Supplier Page | Shop |