| Name | GCDH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2402 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | GCDH antibody was raised using the N terminal of GCDH corresponding to a region with amino acids SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA |
| Purity/Format | Affinity purified |
| Blocking Peptide | GCDH Blocking Peptide |
| Description | Rabbit polyclonal GCDH antibody raised against the N terminal of GCDH |
| Gene | GCDH |
| Supplier Page | Shop |