| Name | EBI3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3648 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | EBI3 antibody was raised using the middle region of EBI3 corresponding to a region with amino acids TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP |
| Purity/Format | Affinity purified |
| Blocking Peptide | EBI3 Blocking Peptide |
| Description | Rabbit polyclonal EBI3 antibody raised against the middle region of EBI3 |
| Gene | EBI3 |
| Supplier Page | Shop |