| Name | SYVN1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1869 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SYVN1 antibody was raised using the middle region of SYVN1 corresponding to a region with amino acids QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAALSRPSGAA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SYVN1 Blocking Peptide |
| Description | Rabbit polyclonal SYVN1 antibody raised against the middle region of SYVN1 |
| Gene | SYVN1 |
| Supplier Page | Shop |