Recombinant Human E-Selectin/CD62E Protein

Images

 

Product Details

Summary
Product Discontinued
View other related E-Selectin/CD62E Peptides and Proteins

Order Details


    • Catalog Number
      H00006401-G01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research

Recombinant Human E-Selectin/CD62E Protein Summary

Description
An un-tagged recombinant protein corresponding to the amino acids 1-610 of Human SELE full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELYGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL

Preparation
Method
in vitro wheat germ expression system with proprietary liposome technology
Protein/Peptide Type
Recombinant Protein
Gene
SELE

Applications/Dilutions

Dilutions
  • Immunoaffinity Purification
Application Notes
In Vitro Wheat Germ System + Liposome Technology offers significant advantages over commonly used protein expression platforms:

Higher Yield
Greater Stability
High Expression Success Rate
Native Protein Conformation

This protein has not yet been tested for use in functional studies and/or compound screening.
All experiments requiring biological activity of the protein will not be backed by the Novus Guarantee or be eligible for the Innovator's Reward™ and must be undertaken at the customer's own risk.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human E-Selectin/CD62E Protein

  • CD62 antigen-like family member E
  • CD62E antigen
  • CD62E
  • ELAM
  • ELAM1
  • ELAM-1
  • ELAM1E-selectin
  • endothelial adhesion molecule 1
  • Endothelial leukocyte adhesion molecule 1
  • ESEL
  • E-Selectin
  • LECAM2
  • leukocyte endothelial cell adhesion molecule 2
  • Leukocyte-endothelial cell adhesion molecule 2
  • SELE
  • selectin E

Background

CD62E (also known as E-selectin, ELAM-1, and LECAM-1) is a 115 kD type I membrane protein and a member of the selectin family. CD62E is highly expressed on activated endothelial cells (IL-2, TNF- alpha, other cytokines can increase expression) and can also be expressed on endothelial cells in the skin, bone marrow and placenta. CD62E is involved in tethering and leucocyte rolling on activated endothelium at inflammatory sites and may also play a role in tumor metastasis and angiogenesis. CD62E binds to both Siayl Lewis X (CD15s) and PSGL-1 (CD162). The HCD62E antibody has been shown to recognize human CD62E and to be useful for flow cytometry.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF796
Species: Mu
Applications: AdBlk, IHC, WB
210-TA
Species: Hu
Applications: BA

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human E-Selectin/CD62E Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SELE