Home » CD30 Ligand/TNFSF8 » CD30 Ligand/TNFSF8 Proteins » Recombinant Human CD30 Ligand/TNFSF8 Protein

Recombinant Human CD30 Ligand/TNFSF8 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related CD30 Ligand/TNFSF8 Peptides and Proteins

Order Details


    • Catalog Number
      H00000944-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research

Recombinant Human CD30 Ligand/TNFSF8 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-234 of Human TNFSF8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Protein/Peptide Type
Recombinant Protein
Gene
TNFSF8

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD30 Ligand/TNFSF8 Protein

  • CD153 antigen
  • CD153
  • CD30 antigen ligand
  • CD30 Ligand
  • CD30L
  • CD30-L
  • CD30LCD30 ligand
  • CD30LGMGC138144
  • TNFSF8
  • tumor necrosis factor (ligand) superfamily, member 8
  • tumor necrosis factor ligand superfamily member 8

Background

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
•••
(3 Reviews)
(827 Publications)
Species: Hu
Applications: BA
CD30/TNFRSF8
Antibody (OTI1C6)
NBP2-46157
Flow Cytometry CD30/TNFRSF8 Antibody (OTI1C6)
•••
(1 Review)
Species: Hu
Applications: Flow, IHC, IHC-P, WB

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD30 Ligand/TNFSF8 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TNFSF8