Home » GSAP » GSAP Proteins » GSAP Recombinant Protein Antigen

GSAP Recombinant Protein Antigen

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related GSAP Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-89581PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research

GSAP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PION.

Source: E. coli

Amino Acid Sequence: SSYWSVYSETSNMDKLLPHSSVLTWNTEIPGITLVTEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHFHYNNSVVRREWHNLISEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PION
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89581.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GSAP Recombinant Protein Antigen

  • GSAP
  • pigeon homolog (Drosophila)
  • PION
  • tcag7.1314

Background

Gamma secretase activating protein (GSAP) is implicated in Alzheimer's disease, through instigating plaque formation of amyloid beta. Immunohistochemistry to identify GSAP in brain can demonstrate its abundance in certain regions of damage, and is usually morphologically changed throughout the progression of Alzheimer's disease. GSAP can be used as a qualitative biomarker of Alzheimer's disease progression, and is regularly considered one of the best targets of therapies to diminish the effects of Alzheimer's disease in affected individuals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

POLR3E Antibody -
BSA Free
NBP1-84621
Western Blot POLR3E Antibody - BSA Free
•••
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EFS Antibody - BSA
Free
NBP2-31993
Immunohistochemistry-Paraffin EFS Antibody - BSA Free
••
Species: Hu
Applications: IHC, IHC-P, WB

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GSAP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PION