Cystatin-8 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:VLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVME |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CST8 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:10-1:20
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Human. Predicted cross-reactivity based on sequence identity: Mouse (61%) and Rat (62%).
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Cystatin-8 Antibody
Background
Cystatin 8, also referred to as CST8, has a 142 amino acid isoform that is 16 kDa, and is involved in reproduction, especially pertaining to sperm development and maturation. Disease research is being conducted between Cystatin 8 and several diseases and disorders to determine the relation between the two. Some of these disorders include epididymitis, cerebral hemorrhage, melanoma, t-cell leukemia, cerebritis, and choriocarcinoma. This protein is not linked to any pathways, and is not known to interact with any other proteins at this time.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ELISA
Species: Hu
Applications: WB
Species: Mu, Rt
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC
Publications for Cystatin-8 Antibody (NBP1-85456) (0)
There are no publications for Cystatin-8 Antibody (NBP1-85456).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cystatin-8 Antibody (NBP1-85456) (0)
There are no reviews for Cystatin-8 Antibody (NBP1-85456).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Cystatin-8 Antibody (NBP1-85456) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cystatin-8 Products
Research Areas for Cystatin-8 Antibody (NBP1-85456)
Find related products by research area.
|
Blogs on Cystatin-8