Sphingomyelin Synthase 2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SGMS2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Sphingomyelin Synthase 2 Antibody - BSA Free
Background
Sphingomyelin (SM) is a major component of plasma membranes. It is preferentially concentrated in the outer leaflet and has a role in the formation of lipid rafts. SM synthases (EC 2.7.8.27), such as SGMS2, produce SM in the lumen of the Golgi and on the cell surface through the transfer of phosphocholine from phosphatidylcholine onto ceramide, yielding diacylglycerol as a side product (Huitema et al., 2004 [PubMed 14685263]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Fi, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Publications for Sphingomyelin Synthase 2 Antibody (NBP1-92436) (0)
There are no publications for Sphingomyelin Synthase 2 Antibody (NBP1-92436).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sphingomyelin Synthase 2 Antibody (NBP1-92436) (0)
There are no reviews for Sphingomyelin Synthase 2 Antibody (NBP1-92436).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Sphingomyelin Synthase 2 Antibody (NBP1-92436) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sphingomyelin Synthase 2 Products
Blogs on Sphingomyelin Synthase 2
![Western Blot: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Western-Blot-NBP1-92436-img0005.jpg "Western Blot: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Analysis in human gallbladder and skeletal muscle tissues. Corresponding SGMS2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0011.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Analysis in human gallbladder and skeletal muscle tissues. Corresponding SGMS2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human gallbladder shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0006.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human gallbladder shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human skeletal muscle shows weak positivity in myocytes.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0007.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human skeletal muscle shows weak positivity in myocytes.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human Fallopian tube shows weak membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0008.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human Fallopian tube shows weak membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human small intestine shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0009.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human small intestine shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human lung shows moderate membranous positivity in pneumocytes.](http://images.novusbio.com/fullsize/Sphingomyelin-Synthase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92436-img0010.jpg "Immunohistochemistry-Paraffin: Sphingomyelin Synthase 2 Antibody [NBP1-92436] - Staining of human lung shows moderate membranous positivity in pneumocytes.")
![Immunohistochemistry Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Immunohistochemistry_11019.jpg)
![Western Blot Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Western_Blot_11065.jpg)
![Knockout Validated Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Knockout_Validated_23118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot SMPD3/NSMase2 Antibody (758612) [Unconjugated]](https://images.novusbio.com/images2/SMPD3_MAB7184_Western_Blot_12188.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")