INPP5A Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFL |
| Predicted Species |
Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
INPP5A |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for INPP5A Antibody - BSA Free
Background
INPP5A is a gene which codes for a protein that functions as a major isoenzyme that hydrolyzes the calcium-mobilizing second messenger Ins(1,4,5)P3 in a signal-terminating reaction and is comprised of 412 amino acids, with a mass of approximately 48 kDa. Studies are being conducted in several diseases and disorders relating to this gene including oculocerebrorenal syndrome, cutaneous T cell lymphoma, squamous cell carcinoma, Fanconi syndrome, schizophrenia, carcinoma, and olivopontocerebellar atrophy. INPP5A has also been shown to have interactions with PLEK, YWHAZ, GRB2, INPP1, and IPMK in pathways such as the inositol phosphate metabolism pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, IHC-Fr, WB
Species: Rt
Applications: WB
Species: Ca, Fe, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IB, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for INPP5A Antibody (NBP1-89361) (0)
There are no publications for INPP5A Antibody (NBP1-89361).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for INPP5A Antibody (NBP1-89361) (0)
There are no reviews for INPP5A Antibody (NBP1-89361).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for INPP5A Antibody (NBP1-89361) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional INPP5A Products
Research Areas for INPP5A Antibody (NBP1-89361)
Find related products by research area.
|
Blogs on INPP5A
![Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Analysis in human endometrium and tonsil tissues. Corresponding INPP5A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/INPP5A-Antibody-Immunohistochemistry-Paraffin-NBP1-89361-img0009.jpg "Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Analysis in human endometrium and tonsil tissues. Corresponding INPP5A RNA-seq data are presented for the same tissues.")
![Western Blot: INPP5A Antibody [NBP1-89361] - Analysis in control (vector only transfected HEK293T lysate) and INPP5A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/INPP5A-Antibody-Western-Blot-NBP1-89361-img0008.jpg "Western Blot: INPP5A Antibody [NBP1-89361] - Analysis in control (vector only transfected HEK293T lysate) and INPP5A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells, as well as very weak positivity in a subset of non-germinal center cells.](http://images.novusbio.com/fullsize/INPP5A-Antibody-Immunohistochemistry-Paraffin-NBP1-89361-img0014.jpg "Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells, as well as very weak positivity in a subset of non-germinal center cells.")
![Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/INPP5A-Antibody-Immunohistochemistry-Paraffin-NBP1-89361-img0010.jpg "Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/INPP5A-Antibody-Immunohistochemistry-Paraffin-NBP1-89361-img0011.jpg "Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human heart muscle shows moderate cytoplasmic positivity, as well as strong immunoreactivity in intercalated discs of cardiomyocytes.](http://images.novusbio.com/fullsize/INPP5A-Antibody-Immunohistochemistry-Paraffin-NBP1-89361-img0012.jpg "Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human heart muscle shows moderate cytoplasmic positivity, as well as strong immunoreactivity in intercalated discs of cardiomyocytes.")
![Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/INPP5A-Antibody-Immunohistochemistry-NBP1-89361-img0013.jpg "Immunohistochemistry-Paraffin: INPP5A Antibody [NBP1-89361] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.")
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")