NXF2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFDPDLMGRDIDIILNRRNCMAATLKITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NXF2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for NXF2 Antibody - BSA Free
Background
The NXF2 gene is one of a family of nuclear RNA export factor genes. It encodes a protein that is involved in mRNA export, is located in the nucleoplasm, and is associated with the nuclear envelope. Alternative splicing seems to be a common mechanism in this
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Publications for NXF2 Antibody (NBP1-85809) (0)
There are no publications for NXF2 Antibody (NBP1-85809).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NXF2 Antibody (NBP1-85809) (0)
There are no reviews for NXF2 Antibody (NBP1-85809).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for NXF2 Antibody (NBP1-85809) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NXF2 Products
Blogs on NXF2
![Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/NXF2-Antibody-Immunohistochemistry-Paraffin-NBP1-85809-img0005.jpg "Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human cerebral cortex shows strong nuclear and moderate cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/NXF2-Antibody-Immunohistochemistry-Paraffin-NBP1-85809-img0002.jpg "Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human cerebral cortex shows strong nuclear and moderate cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human colorectal cancer shows strong positivity in tumor cells.](http://images.novusbio.com/fullsize/NXF2-Antibody-Immunohistochemistry-Paraffin-NBP1-85809-img0003.jpg "Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human colorectal cancer shows strong positivity in tumor cells.")
![Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human fallopian tube shows strong nuclear and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NXF2-Antibody-Immunohistochemistry-Paraffin-NBP1-85809-img0004.jpg "Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human fallopian tube shows strong nuclear and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/NXF2-Antibody-Immunohistochemistry-Paraffin-NBP1-85809-img0006.jpg "Immunohistochemistry-Paraffin: NXF2 Antibody [NBP1-85809] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot ZIP4H/Tex11 Antibody [Unconjugated]](https://images.novusbio.com/images2/ZIP4H_AF5627_Western_Blot_9475.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")