GPR1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GPR1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Publications |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for GPR1 Antibody
Background
GPR1 is an Orphan-A GPCR with an unknown ligand. GPR1 was identified in a search for genes responsible for mediating brain reward and may have a role in drug addiction. It has also been shown to act as an HIV coreceptor in kidney mesangial cells (Tokizawa et al., 2000). GPR1 has been reported to be expressed in brain and kidney. ESTs have been isolated from placenta and thymus libraries. Caution: GPR1 should be distinguished from the yeast protein of the same name.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: Bv, Eq, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Bv, Eq, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: IHC
Publications for GPR1 Antibody (NBP1-87585)(1)
Showing Publication 1 -
1 of 1.
Reviews for GPR1 Antibody (NBP1-87585) (0)
There are no reviews for GPR1 Antibody (NBP1-87585).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GPR1 Antibody (NBP1-87585) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR1 Products
Research Areas for GPR1 Antibody (NBP1-87585)
Find related products by research area.
|
Blogs on GPR1