Novus Biologicals uses cookies to provide you with a great website experience. By continuing to use this website you acknowledge this and agree to our cookie policy.
Note: Mouseover a species abbreviation on the product page to display the fullname.
Images
Orthogonal Strategies: Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Analysis in human fallopian tube and liver tissues using NBP1-85803 antibody. Corresponding PBX1 RNA-seq data are presented for ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Analysis in human fallopian tube and liver tissues using NBP1-85803 antibody. Corresponding PBX1 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium, fallopian tube, liver and prostate using Anti-PBX1 antibody NBP1-85803 (A) shows similar protein ...read more
Orthogonal Strategies: Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in human cell lines HeLa and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/ Immunofluorescence: PBX1 Antibody [NBP1-85803] - Staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.
Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.
Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.
Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human liver shows no positivity in hepatocytes as expected.
This antibody was developed against Recombinant Protein corresponding to amino acids: PRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PBX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for PBX1 Antibody - BSA Free
DKFZp686B09108
Homeobox protein PBX1
Homeobox protein PRL
MGC126627
Pre-B cell leukemia transcription factor-1
pre-B-cell leukemia homeobox 1
pre-B-cell leukemia transcription factor 1
PRL
Background
PBX1 binds the sequence 5'-ATCAATCAA-3'. Acts as a transcriptional activator of PF4 in complex with MEIS1. Converted into a potent transcriptional activator by the (1;19) translocation. May have a role in steroidogenesis and, subsequently, sexual development a
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PBX1 Antibody - BSA Free and receive a gift card or discount.
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Analysis in human fallopian tube and liver tissues using NBP1-85803 antibody. Corresponding PBX1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0011.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Analysis in human fallopian tube and liver tissues using NBP1-85803 antibody. Corresponding PBX1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium, fallopian tube, liver and prostate using Anti-PBX1 antibody NBP1-85803 (A) shows similar protein distribution across tissues to independent antibody NBP1-86151 (B).](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0010.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium, fallopian tube, liver and prostate using Anti-PBX1 antibody NBP1-85803 (A) shows similar protein distribution across tissues to independent antibody NBP1-86151 (B).")
![Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in human cell lines HeLa and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.](http://images.novusbio.com/fullsize/PBX1-Antibody-Western-Blot-NBP1-85803-img0009.jpg "Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in human cell lines HeLa and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.")
![Immunocytochemistry/Immunofluorescence: PBX1 Antibody [NBP1-85803] - Staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85803-img0003.jpg "Immunocytochemistry/Immunofluorescence: PBX1 Antibody [NBP1-85803] - Staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.")
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0014.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.")
![Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/PBX1-Antibody-Western-Blot-NBP1-85803-img0007.jpg "Western Blot: PBX1 Antibody [NBP1-85803] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0012.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0013.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human endometrium shows moderate to strong nuclear positivity in stromal cells.")
![Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PBX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85803-img0015.jpg "Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-85803] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Western_Blot_5176.jpg)
![Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16339.jpg)
![Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Chromatin_Immunoprecipitation_11246.jpg)
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
![Immunocytochemistry STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Immunocytochemistry__Immunofluorescence_17603.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")