TCF19 Antibody (6D8) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
TCF19 (NP_009040, 17 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL |
| Specificity |
TCF19 - transcription factor 19 (SC1) |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TCF19 |
| Purity |
Ascites |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Knockdown Validated
- Western Blot
|
| Application Notes |
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Ascites |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TCF19 Antibody (6D8) - Azide and BSA Free
Background
The 2.6-kb cDNA encodes a deduced 359-amino acid polypeptide with features characteristic of transactivating factors. The gene was mapped by in situ hybridization to chromosome 6p21-p22. The bacterially expressed protein has the predicted size of 39 kD.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Mu
Applications: WB
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Mu
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, KD
Publications for TCF19 Antibody (H00006941-M01) (0)
There are no publications for TCF19 Antibody (H00006941-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TCF19 Antibody (H00006941-M01) (0)
There are no reviews for TCF19 Antibody (H00006941-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TCF19 Antibody (H00006941-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TCF19 Products
Research Areas for TCF19 Antibody (H00006941-M01)
Find related products by research area.
|
Blogs on TCF19
![Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - TCF19 monoclonal antibody (M01), clone 6D8 Analysis of TCF19 expression in Hela S3 NE.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Western-Blot-H00006941-M01-img0013.jpg "Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - TCF19 monoclonal antibody (M01), clone 6D8 Analysis of TCF19 expression in Hela S3 NE.")
![Immunocytochemistry/Immunofluorescence: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Immunocytochemistry-Immunofluorescence-H00006941-M01-img0008.jpg "Immunocytochemistry/Immunofluorescence: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Immunohistochemistry-Paraffin-H00006941-M01-img0010.jpg "Immunohistochemistry-Paraffin: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.")
![Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi ( Cat # H00006941-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody (M01), clone 6D8 (Cat # H00006941-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Western-Blot-H00006941-M01-img0011.jpg "Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi ( Cat # H00006941-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody (M01), clone 6D8 (Cat # H00006941-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody (M01), clone 6D8.Lane 1: TCF19 transfected lysate(37.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-Western-Blot-H00006941-M01-img0014.jpg "Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody (M01), clone 6D8.Lane 1: TCF19 transfected lysate(37.2 KDa).Lane 2: Non-transfected lysate.")
![ELISA: TCF19 Antibody (6D8) [H00006941-M01] - Detection limit for recombinant GST tagged TCF19 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TCF19-Antibody-6D8-ELISA-H00006941-M01-img0015.jpg "ELISA: TCF19 Antibody (6D8) [H00006941-M01] - Detection limit for recombinant GST tagged TCF19 is approximately 0.1ng/ml as a capture antibody.")
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Immunohistochemistry ALCAM/CD166 Antibody [Unconjugated]](https://images.novusbio.com/images2/ALCAM_AF1172_Immunohistochemistry_7112.jpg)
![Immunocytochemistry ALCAM/CD166 Antibody [Unconjugated]](https://images.novusbio.com/images2/ALCAM_AF1172_Immunocytochemistry_12727.jpg)
![Western Blot ALCAM/CD166 Antibody [Unconjugated]](https://images.novusbio.com/images2/ALCAM_AF1172_Western_Blot_19223.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")