The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to WNT7B(wingless-type MMTV integration site family, member 7B) The peptide sequence was selected from the middle region of WNT7B (NP_478679) Peptide sequence WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT7B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in Immunohistochemistry-Frozen reported in scientific literature (PMID25823570)
Theoretical MW
36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-59564 in the following applications:
Mouse reactivity reported in scientific literature (PMID: 29871934)..
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for Wnt-7b Antibody - BSA Free
protein Wnt-7b
wingless-type MMTV integration site family, member 7B
Wnt7b
Wnt-7b
Background
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fat
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Wnt-7b Antibody - BSA Free and receive a gift card or discount.
![Western Blot: Wnt-7b Antibody [NBP1-59564] - Titration: 0.2-1 ug/ml, Positive Control: Human kidney.](http://images.novusbio.com/fullsize/Wnt-7b-Antibody-Western-Blot-NBP1-59564-img0007.jpg "Western Blot: Wnt-7b Antibody [NBP1-59564] - Titration: 0.2-1 ug/ml, Positive Control: Human kidney.")
![Immunohistochemistry-Paraffin: Wnt-7b Antibody [NBP1-59564] - Human Brain, cortex tissue at an antibody concentration of 4-8ug/ml.](http://images.novusbio.com/fullsize/Wnt-7b-Antibody-Immunohistochemistry-Paraffin-NBP1-59564-img0006.jpg "Immunohistochemistry-Paraffin: Wnt-7b Antibody [NBP1-59564] - Human Brain, cortex tissue at an antibody concentration of 4-8ug/ml.")
![Bioactivity Wnt-5a [Unconjugated]](https://images.novusbio.com/images/protein/645-wn_recombinant-human-mouse-wnt-5a-protein-bioactivity-1612202094911.jpg)
![Wnt-2b Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Wnt-2b Antibody [Unconjugated]")
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/Wnt3a_5036WN_2880.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-3112023115329.jpg)
![Cell Culture Wnt-3a [Unconjugated]](https://images.novusbio.com/images/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-252023103514.jpg)
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Western Blot Wnt-7b Antibody [Unconjugated]](https://images.novusbio.com/images2/Wnt-7b_AF3460_Western_Blot_11133.jpg)
![Immunohistochemistry Wnt-7b Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3460_human-wnt-7b-affinity-purified-polyclonal-ab-immunohistochemistry-12122023155533..jpg)
![Western Blot Wnt-7b Antibody [Unconjugated]](https://images.novusbio.com/images/af3460_human-wnt-7b-affinity-purified-polyclonal-ab-41202413392421.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")