| Name | Active human FGF1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191756 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is ≤ 10 ng/ml, corresponding to a specific activity of ≥ 1.0 x 10 5 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P05230 |
| Gene | FGF1 |
| Residue | 16 to 155 |
| Sequence | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAES VGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISK KHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Supplier Page | Shop |