Recombinant Human CKS2 Protein
| Name | Recombinant Human CKS2 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18431 |
| Category | Protein |
| Prices | $299.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | >95% pure by SDS-PAGE |
| Gene | CKS2 |
| Sequence | MASMTGGQQMGRGSHMAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
| Description | A recombinant protein corresponding to amino acids 1 - 79 of CKS2 |
| Supplier Page | Shop |
Product images
![SDS-Page: CKS2 Protein [NBC1-18431] - CKS2, 11.3kDa (94aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/29431_CKS2%2520Protein-SDS-Page-NBC1-18431-img0001.jpg)
SDS-Page: CKS2 Protein [NBC1-18431] - CKS2, 11.3kDa (94aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE