Recombinant Human FGF acidic/FGF1 Protein
| Name | Recombinant Human FGF acidic/FGF1 Protein |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBC1-18465 |
| Category | Protein |
| Prices | $329.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | >95% pure by SDS-PAGE |
| Bioactivity | The ED50 for this effect is < 2.9 ng/ml, measured in a cell proliferation assay using NIH-3T3 cell (which corresponds to > 340,000 units/ml). |
| Gene | FGF1 |
| Sequence | MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Description | A recombinant protein corresponding to FGF1 |
| Supplier Page | Shop |
Product images
![SDS-Page: Recombinant Human FGF acidic/FGF1 Protein [NBC1-18465] - aFGF, 15.9kDa (141aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE](http://www.bioprodhub.com/system/product_images/pp_products/5/sub_1/20502_Recombinant-Human-FGF-acidic-FGF1-Protein-SDS-Page-NBC1-18465-img0002.jpg)
SDS-Page: Recombinant Human FGF acidic/FGF1 Protein [NBC1-18465] - aFGF, 15.9kDa (141aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE