Human CCR2 protein fragment
| Name | Human CCR2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114168 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P41597 |
| Gene | CCR2 |
| Residue | 1 to 42 |
| Sequence | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
| Supplier Page | Shop |
Product images
ab114168 on a 12.5% SDS-PAGE Stained with Coomassie Blue.