Human ATOX1 full length protein

Name Human ATOX1 full length protein
Supplier Abcam
Catalog ab116474
Category Protein
Prices $188.00
Sizes 5 µg
Applications SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Tag/Conjugation His tag N-Terminus
Purity > 95 % by SDS-PAGE. ab116474 is purified by proprietary chromatographic techniques and filter sterilized.
SwissProt/Accession O00244
Gene ATOX1
Residue 1 to 68
Sequence MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVK YDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Supplier Page Shop