Human ALG10 protein fragment
| Name | Human ALG10 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab164694 |
| Category | Protein |
| Prices | $402.00 |
| Sizes | 10 µg |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| Gene | ALG10 |
| Residue | 48 to 97 |
| Sequence | KLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLLLL |
| Supplier Page | Shop |
Product images
ab164694 on a 12.5% SDS-PAGE stained with Coomassie Blue.