Active human BCMA protein fragment
| Name | Active human BCMA protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab184887 |
| Category | Protein |
| Prices | $735.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized recombinant human BAFF at 1 μg/ml ( 100 μl/well ) can bind rh BCMA. The EC 50 of Human BCMA is 0.08 μg/ml |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q02223 |
| Gene | TNFRSF17 |
| Residue | 1 to 54 |
| Sequence | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK GTNA |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab184887 by DTT-reduced (1) and non-reduced (2) SDS-PAGE with staining overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced Protein migrates as 35-40 kDa and non-reduced protein migrates as 66 kDa.