Active human Amphiregulin full length protein
| Name | Active human Amphiregulin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab104355 |
| Category | Protein |
| Prices | $110.00, $316.00 |
| Sizes | 10 µg, 50 µg |
| Applications | SDS-PAGE FA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. Purity is > 95% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter. |
| Bioactivity | Determined by its ability to stimulate the proliferation of mouse Balb/c 3T3 cells. The expected ED 50 for this effect is 5-10 ng/ml. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P15514 |
| Gene | AREG |
| Residue | 101 to 198 |
| Sequence | SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEF QNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK |
| Supplier Page | Shop |
Product images
![Anti-Amphiregulin antibody [MM0089-8K16] ( ab89119 ) at 1/500 dilution + Active human Amphiregulin full length protein (ab104355) at 0.1 µg Secondary Goat Anti-Mouse IgG H&L (HRP) preadsorbed ( ab97040 ) at 1/5000 dilution developed using the ECL technique Performed under reducing conditions. Exposure time : 8 minutes](http://www.bioprodhub.com/system/product_images/pp_products/2/sub_1/180_Amphiregulin-Primary-antibodies-ab89119-3.jpg)
Anti-Amphiregulin antibody [MM0089-8K16] ( ab89119 ) at 1/500 dilution + Active human Amphiregulin full length protein (ab104355) at 0.1 µg Secondary Goat Anti-Mouse IgG H&L (HRP) preadsorbed ( ab97040 ) at 1/5000 dilution developed using the ECL technique Performed under reducing conditions. Exposure time : 8 minutes