Recombinant human Eukaryotic translation initiation factor 3 subunit F protein

Name Recombinant human Eukaryotic translation initiation factor 3 subunit F protein
Supplier Cusabio
Catalog CSB-EP030844h CSB-BP030844h CSB-MP030844h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
Purity 90%
SwissProt/Accession O00303
Gene EIF3F
Residue 2-250aa
Sequence ATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVD
Description Partial of the full length of 2-357aa
Supplier Page Shop