Recombinant human Transcription termination factor 1

Name Recombinant human Transcription termination factor 1
Supplier Cusabio
Catalog CSB-EP116774h(N) CSB-BP116774h(N) CSB-MP116774h(N)
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation His-tag
SwissProt/Accession Q15361
Gene TTF1
Residue 11-242aa
Sequence TPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQHLISSPLKKSRICDETANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFRKDVDVVCVDMSIEQKLPRKPKTDKFQVLAKSHAHKSEALHSKVREKKNKKHQRKAASWESQRARDTLPQSESHQEESWLSVGPGGEITELPASAHKNKSKKKKKKSSNREYE
Description Partial of the full length of 1-905aa
Supplier Page Shop