Recombinant Human RAD51C

Name Recombinant Human RAD51C
Supplier Creative Biomart
Catalog RAD51C-28601TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession O43502
Gene RAD51C
Sequence MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL
Description Recombinant fragment of Human Rad51C with a N terminal proprietary tag; Predicted MWt 40.48 kDa including the tag.
Supplier Page Shop