| Name | Recombinant Human NCAM1 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | NCAM1-30370TH |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P13591 |
| Gene | NCAM1 |
| Sequence | EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP |
| Description | Recombinant fragment corresponding to amino acids 611-710 of Human NCAM with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
| Supplier Page | Shop |