Active rat IL5 full length protein

Name Active rat IL5 full length protein
Supplier Abcam
Catalog ab192102
Category Protein
Prices $192.00
Sizes 10 µg
Applications FA SDS-PAGE
Species Reactivities Rat
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED 50 determined by the dose-dependent proliferation of TF-1 cells was ≤ 0.2 ng/mL, corresponding to a specific activity of ≥ 6.0 x 10 6 units/mg.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P05113
Gene IL5
Residue 20 to 132
Sequence MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL DILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQE FLGVMSTEWAMEV
Supplier Page Shop