Active rat IL4 full length protein

Name Active rat IL4 full length protein
Supplier Abcam
Catalog ab200289
Category Protein
Prices $107.00
Sizes 5 µg
Applications SDS-PAGE FA HPLC
Species Reactivities Rat
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED 50 as determined by a cell proliferation assay using rat splenocytes is less than 1.0 ng/mL, corresponding to a specific activity of > 1.0 x 10 6 IU/mg.
SwissProt/Accession P05112
Gene IL4
Residue 23 to 147
Sequence HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRAS RVLRKFYFPRDVPPCLKNKSGVLGELRKLCRGVSGLNSLRSCTVNESTLT TLKDFLESLKSILRGKYLQSCTSMS
Supplier Page Shop