Recombinant Human FPR2

Name Recombinant Human FPR2
Supplier Creative Biomart
Catalog FPR2-28948TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P25090
Gene FPR2
Sequence FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Description Recombinant fragment corresponding to amino acids 163-205 of Human FPRL1 with an N terminal proprietary tag; Predicted MWt 30.36 kDa.
Supplier Page Shop