| Name | Recombinant Human FADS1 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | FADS1-28816TH |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | O60427 |
| Gene | FADS1 |
| Sequence | MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS |
| Description | Recombinant fragment corresponding to amino acids 1-99 of Human FADS1, with a N terminal proprietary tag; predicted MW: 36.52 inclusive of tag |
| Supplier Page | Shop |