| Name | Recombinant Human EIF6 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | EIF6-26861TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P56537 |
| Gene | EIF6 |
| Sequence | VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT |
| Description | Recombinant fragment: VLVGSYCVFS NQGGLVHPKT SIEDQDELSS LLQVPLVAGT VNRGSEVIAA GMVVNDWCAF CGLDTTSTEL SVVESVFKLN EAQPSTIATS MRDSLIDSLT of Human integrin beta 4 binding protein (amino acids 146-245) with N terminal proprietary tag, 36.63 kDa. |
| Supplier Page | Shop |