| Name | Active rat EGF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab123750 |
| Category | Protein |
| Prices | $210.00 |
| Sizes | 20 µg |
| Applications | HPLC FA SDS-PAGE |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. ab123750 is purified by proprietary chromatographic techniques. The Rat EGF Purity is greater than 98% as determined by HPLC and SDS-PAGE. |
| Bioactivity | The ED 50 as calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells is less than 0.1ng/ml, corresponding to a specific activity of > 1 x 10 7 units/mg. |
| SwissProt/Accession | P01133 |
| Gene | EGF |
| Residue | 974 to 1026 |
| Sequence | NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWW KLR |
| Supplier Page | Shop |