Recombinant Human DHX9

Name Recombinant Human DHX9
Supplier Creative Biomart
Catalog DHX9-30765TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q08211
Gene DHX9
Sequence MGDVKNFLYAWCGKRKMTPTYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Description Recombinant fragment, corresponding to amino acids 1-90 of Human RNA Helicase A, with an N-terminal proprietary tag, predicted MWt 35.53 kDa
Supplier Page Shop