| Name | Recombinant Human CLTC |
|---|---|
| Supplier | Creative Biomart |
| Catalog | CLTC-26707TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | Q00610 |
| Gene | CLTC |
| Sequence | EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN |
| Description | Recombinant fragment (amino acids 232-340) of Human Clathrin heavy chain with proprietary 26 kDa tag; 109 amino acids (Predicted MW 12.09 kDa), 37.62 kDa inclusive of tag. |
| Supplier Page | Shop |