Recombinant Human CKS2, T7 -tagged

Name Recombinant Human CKS2, T7 -tagged
Supplier Creative Biomart
Catalog CKS2-26704TH
Category Protein
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE
SwissProt/Accession P33552
Gene CKS2
Sequence MASMTGGQQMGRGSHMAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
Description Recombinant full length protein corresponding to amino acids 1-79 of Human CKS2, fused to a T7 Tag at N-terminal, MWt 11kDa.
Supplier Page Shop