| Name | Recombinant Human CDH5 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | CDH5-31200TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P33151 |
| Gene | CDH5 |
| Sequence | WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV |
| Description | Recombinant fragment (amino acids 51-150) of Human VE Cadherin with proprietary 26 kDa tag; 100 amino acids (Predicted MW 11.45 kDa), 36.63 kDa inclusive of tag. |
| Supplier Page | Shop |