Recombinant Human CDH5

Name Recombinant Human CDH5
Supplier Creative Biomart
Catalog CDH5-31200TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P33151
Gene CDH5
Sequence WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV
Description Recombinant fragment (amino acids 51-150) of Human VE Cadherin with proprietary 26 kDa tag; 100 amino acids (Predicted MW 11.45 kDa), 36.63 kDa inclusive of tag.
Supplier Page Shop